Recombinant Human ACSM3 Protein, GST-tagged

• Cat.No.: ACSM3-206H
• Product Overview: Human ACSM3 partial ORF ( NP_973729.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ACSM3 (Acyl-CoA Synthetase Medium-Chain Family Member 3) is a Protein Coding gene. Diseases associated with ACSM3 include Hypertension, Essential. Among its related pathways are Mitochondrial Fatty Acid Beta-Oxidation and Metabolism. GO annotations related to this gene include butyrate-CoA ligase activity and fatty acid ligase activity. An important paralog of this gene is ACSM4.
• Molecular Mass: 36.63 kDa
• AA Sequence: MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACSM3 acyl-CoA synthetase medium-chain family member 3 [ Homo sapiens ]
• Official Symbol: ACSM3
• Synonyms: ACSM3; acyl-CoA synthetase medium-chain family member 3; SA (rat hypertension associated) homolog , SA hypertension associated homolog (rat) , SAH; acyl-coenzyme A synthetase ACSM3, mitochondrial; SA; protein SA homolog; butyrate--CoA ligase 3; butyryl-coenzyme A synthetase 3; SA hypertension-associated homolog; middle-chain acyl-CoA synthetase 3; SA (rat hypertension-associated) homolog; SAH
• Gene ID: 6296
• mRNA Refseq: NM_005622
• Protein Refseq: NP_005613
• MIM: 145505
• UniProt ID: Q53FZ2