Recombinant Human ACSM1 Protein, GST-tagged

• Cat.No.: ACSM1-204H
• Product Overview: Human ACSM1 partial ORF ( NP_443188.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ACSM1 (Acyl-CoA Synthetase Medium-Chain Family Member 1) is a Protein Coding gene. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include GTP binding and fatty acid ligase activity. An important paralog of this gene is ACSM4.
• Molecular Mass: 37.84 kDa
• AA Sequence: MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWAQKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACSM1 acyl-CoA synthetase medium-chain family member 1 [ Homo sapiens ]
• Official Symbol: ACSM1
• Synonyms: BUCS1; MACS1
• Gene ID: 116285
• mRNA Refseq: NM_052956.2
• Protein Refseq: NP_443188.2
• MIM: 614357
• UniProt ID: Q08AH1