Recombinant Human ACSM1 Protein, GST-tagged
Cat.No. : | ACSM1-204H |
Product Overview : | Human ACSM1 partial ORF ( NP_443188.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ACSM1 (Acyl-CoA Synthetase Medium-Chain Family Member 1) is a Protein Coding gene. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include GTP binding and fatty acid ligase activity. An important paralog of this gene is ACSM4. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWAQKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACSM1 acyl-CoA synthetase medium-chain family member 1 [ Homo sapiens ] |
Official Symbol | ACSM1 |
Synonyms | BUCS1; MACS1 |
Gene ID | 116285 |
mRNA Refseq | NM_052956.2 |
Protein Refseq | NP_443188.2 |
MIM | 614357 |
UniProt ID | Q08AH1 |
◆ Recombinant Proteins | ||
ACSM1-8165H | Recombinant Human ACSM1 protein, His & T7-tagged | +Inquiry |
ACSM1-274M | Recombinant Mouse ACSM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSM1-203H | Recombinant Human ACSM1 Protein, GST-tagged | +Inquiry |
ACSM1-1230M | Recombinant Mouse ACSM1 Protein | +Inquiry |
ACSM1-806HF | Recombinant Full Length Human ACSM1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSM1-9072HCL | Recombinant Human ACSM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSM1 Products
Required fields are marked with *
My Review for All ACSM1 Products
Required fields are marked with *
0
Inquiry Basket