Recombinant Human ACRV1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ACRV1-2640H
• Product Overview: ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.2 kDa
• AA Sequence: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ACRV1 acrosomal vesicle protein 1 [ Homo sapiens (human) ]
• Official Symbol: ACRV1
• Synonyms: ACRV1; acrosomal vesicle protein 1; acrosomal protein SP-10; D11S4365; SP 10; SPACA2; sperm protein 10; SP-10
• Gene ID: 56
• mRNA Refseq: NM_020110
• Protein Refseq: NP_064495
• MIM: 102525
• UniProt ID: P26436