Recombinant Human ACOT9 Protein, GST-Tagged
Cat.No. : | ACOT9-145H |
Product Overview : | Human ACATE2 full-length ORF ( AAH12573, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Molecular Mass : | 49.06 kDa |
AA Sequence : | MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACOT9 acyl-CoA thioesterase 9 [ Homo sapiens ] |
Official Symbol | ACOT9 |
Synonyms | ACOT9; acyl-CoA thioesterase 9; acyl-coenzyme A thioesterase 9, mitochondrial; ACATE2; CGI 16; MT ACT48; acyl-CoA thioester hydrolase 9; mitochondrial Acyl-CoA Thioesterase; acyl-Coenzyme A thioesterase 2, mitochondrial; CGI-16; MTACT48; MT-ACT48; |
Gene ID | 23597 |
mRNA Refseq | NM_001033583 |
Protein Refseq | NP_001028755 |
MIM | 300862 |
UniProt ID | Q9Y305 |
◆ Recombinant Proteins | ||
ACOT9-05HFL | Recombinant Human Acyl CoA Thioesterase 9 Protein, Flag tagged | +Inquiry |
ACOT9-3818H | Recombinant Human ACOT9 protein, His-tagged | +Inquiry |
ACOT9-2049C | Recombinant Chicken ACOT9 | +Inquiry |
ACOT9-5404H | Recombinant Human ACOT9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACOT9-915HF | Recombinant Full Length Human ACOT9 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOT9-15HCL | Recombinant Human ACOT9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACOT9 Products
Required fields are marked with *
My Review for All ACOT9 Products
Required fields are marked with *
0
Inquiry Basket