Recombinant Human ACBD5 Protein, GST-Tagged

• Cat.No.: ACBD5-149H
• Product Overview: Human ACBD5 full-length ORF ( NP_663736.1, 1 a.a. - 490 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the acyl-Coenzyme A binding protein family, known to function in the transport and distribution of long chain acyl-Coenzyme A in cells. This gene may play a role in the differentiation of megakaryocytes and formation of platelets. A related protein in yeast is involved in autophagy of peroxisomes. A mutation in this gene has been associated with autosomal dominant thrombocytopenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 61.2 kDa
• AA Sequence: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACBD5 acyl-CoA binding domain containing 5 [ Homo sapiens ]
• Official Symbol: ACBD5
• Synonyms: ACBD5; acyl-CoA binding domain containing 5; acyl Coenzyme A binding domain containing 5; acyl-CoA-binding domain-containing protein 5; DKFZp434A2417; KIAA1996; endozepine-related protein; acyl-Coenzyme A binding domain containing 5; membrane-associated diazepam binding inhibitor
• Gene ID: 91452
• mRNA Refseq: NM_001042473
• Protein Refseq: NP_001035938
• UniProt ID: Q5T8D3