Recombinant Human ACBD5 Protein, GST-Tagged

Cat.No. : ACBD5-149H
Product Overview : Human ACBD5 full-length ORF ( NP_663736.1, 1 a.a. - 490 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the acyl-Coenzyme A binding protein family, known to function in the transport and distribution of long chain acyl-Coenzyme A in cells. This gene may play a role in the differentiation of megakaryocytes and formation of platelets. A related protein in yeast is involved in autophagy of peroxisomes. A mutation in this gene has been associated with autosomal dominant thrombocytopenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 61.2 kDa
AA Sequence : MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACBD5 acyl-CoA binding domain containing 5 [ Homo sapiens ]
Official Symbol ACBD5
Synonyms ACBD5; acyl-CoA binding domain containing 5; acyl Coenzyme A binding domain containing 5; acyl-CoA-binding domain-containing protein 5; DKFZp434A2417; KIAA1996; endozepine-related protein; acyl-Coenzyme A binding domain containing 5; membrane-associated diazepam binding inhibitor;
Gene ID 91452
mRNA Refseq NM_001042473
Protein Refseq NP_001035938
UniProt ID Q5T8D3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACBD5 Products

Required fields are marked with *

My Review for All ACBD5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon