Recombinant Human ABHD17B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ABHD17B-3643H
• Product Overview: FAM108B1 MS Standard C13 and N15-labeled recombinant protein (NP_057098) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: ABHD17B (Abhydrolase Domain Containing 17B, Depalmitoylase) is a Protein Coding gene. Diseases associated with ABHD17B include Acrofacial Dysostosis 1, Nager Type. Gene Ontology (GO) annotations related to this gene include hydrolase activity and serine-type peptidase activity. An important paralog of this gene is ABHD17A.
• Molecular Mass: 32.6 kDa
• AA Sequence: MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQELVQKHKEGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ABHD17B abhydrolase domain containing 17B, depalmitoylase [ Homo sapiens (human) ]
• Official Symbol: ABHD17B
• Synonyms: ABHD17B; abhydrolase domain containing 17B, depalmitoylase; CGI-67; C9orf77; FAM108B1; alpha/beta hydrolase domain-containing protein 17B; abhydrolase domain-containing protein 17B; abhydrolase domain-containing protein FAM108B1; epididymis secretory sperm binding protein; family with sequence similarity 108, member B1; protein ABHD17B; EC 3.1.2.22
• Gene ID: 51104
• mRNA Refseq: NM_016014
• Protein Refseq: NP_057098
• MIM: 617943
• UniProt ID: Q5VST6