Recombinant Human ABHD14B Protein, GST-Tagged

• Cat.No.: ABHD14B-077H
• Product Overview: Human ABHD14B full-length ORF ( NP_116139.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ABHD14B (Abhydrolase Domain Containing 14B) is a Protein Coding gene. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD14A.
• Molecular Mass: 48.7 kDa
• AA Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABHD14B abhydrolase domain containing 14B [ Homo sapiens ]
• Official Symbol: ABHD14B
• Synonyms: ABHD14B; abhydrolase domain containing 14B; abhydrolase domain-containing protein 14B; CIB; MGC15429; CCG1-interacting factor B; cell cycle gene 1-interacting factor B
• Gene ID: 84836
• mRNA Refseq: NM_001146314
• Protein Refseq: NP_001139786
• UniProt ID: Q96IU4