Recombinant Human ABCD1 protein, His-tagged

• Cat.No.: ABCD1-4543H
• Product Overview: Recombinant Human ABCD1 protein(334-507 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 334-507 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG

Gene Information

• Gene Name: ABCD1 ATP-binding cassette, sub-family D (ALD), member 1 [ Homo sapiens ]
• Official Symbol: ABCD1
• Synonyms: ABCD1; ATP-binding cassette, sub-family D (ALD), member 1; ALD; ATP-binding cassette sub-family D member 1; adrenoleukodystrophy; ALDP; AMN; adrenoleukodystrophy protein; ABC42
• Gene ID: 215
• mRNA Refseq: NM_000033
• Protein Refseq: NP_000024
• MIM: 300371
• UniProt ID: P33897