Recombinant Human ABCC4 protein, His-tagged

• Cat.No.: ABCC4-2452H
• Product Overview: Recombinant Human ABCC4 protein(567-709 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 567-709 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: AEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ABCC4 ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [ Homo sapiens ]
• Official Symbol: ABCC4
• Synonyms: ABCC4; ATP-binding cassette, sub-family C (CFTR/MRP), member 4; multidrug resistance-associated protein 4; bA464I2.1 (ATP binding cassette; sub family C (CFTR/MRP); member 4); canalicular multispecific organic anion transporter (ABC superfamily); EST170205; MOAT B; MOATB; MRP4; multidrug resistance associated protein 4; multispecific organic anion transporter B; MRP/cMOAT-related ABC transporter; ATP-binding cassette sub-family C member 4; multi-specific organic anion transporter B; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); MOAT-B
• Gene ID: 10257
• mRNA Refseq: NM_001105515
• Protein Refseq: NP_001098985
• MIM: 605250
• UniProt ID: O15439