Recombinant Human ABCB1 protein, GST-tagged

• Cat.No.: ABCB1-6744H
• Product Overview: Recombinant Human ABCB1 protein(624-708 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-GST
• ProteinLength: 624-708 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ]
• Official Symbol: ABCB1
• Synonyms: ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp; P-glycoprotein 1; colchicin sensitivity; doxorubicin resistance; CLCS; MDR1; P-GP; PGY1
• Gene ID: 5243
• mRNA Refseq: NM_000927
• Protein Refseq: NP_000918
• MIM: 171050
• UniProt ID: P08183