Recombinant Human ABCA1 protein, His-tagged
Cat.No. : | ABCA1-3140H |
Product Overview : | Recombinant Human ABCA1 protein(106-305 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 106-305 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | FSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSDMRQEVMFLTNVNSSSSSTQIYQAVS |
Gene Name | ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ] |
Official Symbol | ABCA1 |
Synonyms | ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1; |
Gene ID | 19 |
mRNA Refseq | NM_005502 |
Protein Refseq | NP_005493 |
UniProt ID | O95477 |
◆ Recombinant Proteins | ||
ACLY-2488H | Recombinant Human ACLY protein, His-tagged | +Inquiry |
ACLY-1907H | Recombinant Human ACLY Protein (4-265 aa), His-SUMO-tagged | +Inquiry |
ACLY-0220H | Recombinant Human ACLY Protein (M1-M1101), Tag Free | +Inquiry |
Acly-3743R | Recombinant Rat Acly, His-tagged | +Inquiry |
ACLY-2254C | Recombinant Chicken ACLY | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACLY-509HCL | Recombinant Human ACLY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACLY Products
Required fields are marked with *
My Review for All ACLY Products
Required fields are marked with *
0
Inquiry Basket