Recombinant Human AAMDC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AAMDC-1283H
Product Overview : C11orf67 MS Standard C13 and N15-labeled recombinant protein (NP_078960) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May play a role in preadipocyte differentiation and adipogenesis.
Molecular Mass : 13.3 kDa
AA Sequence : MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AAMDC adipogenesis associated Mth938 domain containing [ Homo sapiens (human) ]
Official Symbol AAMDC
Synonyms AAMDC; adipogenesis associated Mth938 domain containing; CK067; PTD015; C11orf67; mth938 domain-containing protein; UPF0366 protein C11orf67; adipogenesis associated Mth938 domain-containing protein
Gene ID 28971
mRNA Refseq NM_024684
Protein Refseq NP_078960
UniProt ID Q9H7C9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AAMDC Products

Required fields are marked with *

My Review for All AAMDC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon