Recombinant Human AADAC Protein, GST-tagged

• Cat.No.: AADAC-011H
• Product Overview: Human AADAC partial ORF ( NP_001077, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AADAC arylacetamide deacetylase (esterase) [ Homo sapiens ]
• Official Symbol: AADAC
• Synonyms: AADAC; arylacetamide deacetylase (esterase); arylacetamide deacetylase; CES5A1; DAC
• Gene ID: 13
• mRNA Refseq: NM_001086
• Protein Refseq: NP_001077
• MIM: 600338
• UniProt ID: P22760