Recombinant HRV-89 P1A protein, His-tagged
Cat.No. : | P1A-4207H |
Product Overview : | Recombinant HRV-89 P1A protein(P07210)(575-866aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HRV89 |
Source : | E.coli |
Tag : | His |
ProteinLength : | 575-866aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Native Proteins | ||
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJA4-492HCL | Recombinant Human DNAJA4 cell lysate | +Inquiry |
GMPPA-5879HCL | Recombinant Human GMPPA 293 Cell Lysate | +Inquiry |
EDEM3-6724HCL | Recombinant Human EDEM3 293 Cell Lysate | +Inquiry |
FZD1-2633MCL | Recombinant Mouse FZD1 cell lysate | +Inquiry |
NRCAM-1220HCL | Recombinant Human NRCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All P1A Products
Required fields are marked with *
My Review for All P1A Products
Required fields are marked with *
0
Inquiry Basket