Recombinant HPV35 major capsid L1 Protein, His-tag

• Cat.No.: L1-04H
• Product Overview: Recombinant HPV35 major capsid L1 Protein with C-terminal His6 fusion tag was expressed in E. coli.

Specification

• Description: Forms an icosahedral capsid with a T=7 symmetry and a 50 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with L2 proteins. Binds to heparan sulfate proteoglycans on cell surface of basal layer keratinocytes to provide initial virion attachment. This binding mediates a conformational change in the virus capsid that facilitates efficient infection. The virion enters the host cell via endocytosis. During virus trafficking, L1 protein dissociates from the viral DNA and the genomic DNA is released to the host nucleus. The virion assembly takes place within the cell nucleus. Encapsulates the genomic DNA together with protein L2.
• Source: E. coli
• Species: Human Papillomavirus 35
• Tag: His
• Form: Buffered aqueous solution
• Molecular Mass: 57 kDa
• Protein length: 504
• AA Sequence: MSLWRSNEATVYLPPVSVSKVVSTDEYVTRTNIYYHAGSSRLLAVGHPYYAIKKQDSNKIAVPKVSGLQYRVFRVKLPDPNKFGFPDTSFYDPASQRLVWACTGVEVGRGQPLGVGISGHPLLNKLDDTENSNKYVGNSGTDNRECISMDYKQTQLCLIGCRPPIGEHWGKGTPCNANQVKAGECPPLELLNTVLQDGDMVDTGFGAMDFTTLQANKSDVPLDICSSICKYPDYLKMVSEPYGDMLFFYLRREQMFVRHLFNRAGTVGETVPADLYIKGTTGTLPSTSYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWSNQLFVTVVDTTRSTNMSVCSAVSSSDSTYKNDNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNPSILEDWNFGLTPPPSGTLEDTYRYVTSQAVTCQKPSAPKPKDDPLKNYTFWEVDLKEKFSADLDQFPLGRKFLLQAGLKARPNFRLGKRAAPASTSKKSSTKRRHHHHHH
• Endotoxin: ＜0.01EU/ug by LAL
• Purity: ＞95% by SDS-PAGE
• Applications: Antigen for antibody production
  ELISA
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.173 mg/ml
• Storage Buffer: Solution in 20mM Tris, 0.5 M NaCl, pH6.2, 0.5M Arginine，10% Glycerol

Gene Information

• Gene Name: L1
• Official Symbol: major capsid L1 protein
• Synonyms: major capsid L1 protein
• Gene ID: 1403644
• mRNA Refseq: X74477.1
• Protein Refseq: P27232.2
• UniProt ID: P27232