Recombinant HPV-11 E7 Protein, His&Myc-tagged

• Cat.No.: E7-01H
• Product Overview: Recombinant HPV-11 E7 Protein(P04020)(1-98aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: HPV11
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 1-98aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.3 kDa
• AA Sequence: MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.