Recombinant HER2/neu (478-584)
Cat.No. : | ERBB2-01 |
Availability | April 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | Non |
Form : | 20mM Tris-HCl, pH8.0, 200mM NaCl |
Molecular Mass : | (Theoretical molecular weight): ~12kDa |
AA Sequence : | LCFVHTVPWDQLFRNPHQALLHSGNRPEEDCGLEGLVCNSLCAHGHCWGPGPTQCVNCSH FLRGQECVEECRVWKGLPREYVSDKRCLPCHPECQPQNSSETCFGSE |
Purity : | >92% as determined by SDS-PAGE |
Storage : | Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. |
Gene Name | erbb2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog [ Xenopus laevis ] |
Official Symbol | ERBB2 |
Synonyms | ERBB2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; receptor tyrosine kinase ErbB2; |
Gene ID | 724075 |
mRNA Refseq | NM_001095593 |
Protein Refseq | NP_001089062 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; Focal adhesion, organism-specific biosystem; |
◆ Recombinant Proteins | ||
ERBB2-1913R | Active Recombinant Rabbit ERBB2 protein, His-tagged | +Inquiry |
ERBB2-28688TH | Recombinant Human ERBB2, GST-tagged | +Inquiry |
Erbb2-4097RF | Recombinant Rat Erbb2 Protein, Fc-tagged, FITC conjugated | +Inquiry |
ERBB2-1217CF | Recombinant Cynomolgus ERBB2 Protein, His-tagged, FITC conjugated | +Inquiry |
ERBB2-1236C | Active Recombinant Cynomolgus ERBB2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB2-2658HCL | Recombinant Human ERBB2 cell lysate | +Inquiry |
ERBB2-001CCL | Recombinant Cynomolgus ERBB2 cell lysate | +Inquiry |
ERBB2-2010RCL | Recombinant Rat ERBB2 cell lysate | +Inquiry |
ERBB2-465HCL | Recombinant Human ERBB2 cell lysate | +Inquiry |
ERBB2-1727MCL | Recombinant Mouse ERBB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question1.Prepare the streptavidin-coated plate by washing it with PBS (phosphate-buffered saline) or another suitable buffer to remove any impurities. 2.Dilute the Avi-tagged protein in the desired buffer at the desired concentration. It is important to use a buffer that is compatible with the protein and does not interfere with its activity or stability. 3.Add the diluted protein to the streptavidin-coated plate and incubate it for a suitable amount of time at room temperature or 4°C. The exact conditions will depend on the specific protein and the desired level of immobilization. 4.Wash the plate with a suitable buffer to remove any unbound protein. 5.Block the remaining binding sites on the plate with a suitable blocking agent such as BSA (bovine serum albumin) or casein. 6.Wash the plate again to remove any unbound blocking agent. 7.Use the immobilized protein for further experiments such as ELISA, Western blotting, or other assays.
Ask a Question for All ERBB2 Products
Required fields are marked with *
My Review for All ERBB2 Products
Required fields are marked with *
Inquiry Basket