Recombinant HCoV-NL63 N Protein, His-SUMO-tagged(N-ter)
Cat.No. : | N-254H |
Product Overview : | Recombinant HCoV-NL63 N Protein with His-SUMO tag (N-ter) was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HCoV-NL63 |
Source : | HEK293 |
Tag : | His&SUMO |
Description : | Coronaviruses are named for the crown-like spikes on their surface. There are four main sub-groupings of coronaviruses, known as 229E (alpha coronavirus), NL63 (alpha coronavirus), OC43 (beta coronavirus), HKU1 (beta coronavirus). |
Form : | Powder |
AA Sequence : | MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | N nucleocapsid protein [ Human coronavirus NL63 ] |
Official Symbol | N |
Synonyms | N; nucleocapsid protein; nucleocapsid protein; nucleoprotein |
Gene ID | 2943504 |
Protein Refseq | YP_003771 |
UniProt ID | Q6Q1R8 |
◆ Cell & Tissue Lysates | ||
NP-004HCL | Recombinant H5N1 NP cell lysate | +Inquiry |
NP-003HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
NP-479HCL | Recombinant H2N2 NP cell lysate | +Inquiry |
NP-002HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
NP-001HCL | Recombinant H1N1 NP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NP Products
Required fields are marked with *
My Review for All NP Products
Required fields are marked with *
0
Inquiry Basket