Recombinant Haemophilus influenzae nrfB Protein
Cat.No. : | nrfB-108H |
Product Overview : | Recombinant Haemophilus influenzae nrfB Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus influenzae |
Source : | E.coli |
Description : | Cytochrome c nitrite reductase pentaheme subunit |
Form : | Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl. |
Molecular Mass : | ~23.7 kDa |
AA Sequence : | DDAQKPADHVTYEPQLDNQRDPNQYCAKCHKFDKIDKNQTLDRSGGELHFGKFHGAHLDKKNPNNGKAITCVSCHGNVSENHRRGAKDVMRFEGDIFGNKKPMYSVQEQNQVCFACHQPDKLREKLWAHDVHAMKLPCASCHTLHPKEDAMKGIQPKQRVKLCVDCHGKQQKRKAEQDKLTKQKDKQ |
Purity : | >85% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 1.1 mg/ml |
Gene Name | nrfB cytochrome c nitrite reductase pentaheme subunit [ Haemophilus influenzae ] |
Official Symbol | nrfB |
Gene ID | 72525693 |
Protein Refseq | WP_005647730 |
UniProt ID | P45016 |
◆ Recombinant Proteins | ||
RFL32932CF | Recombinant Full Length Crucihimalaya Wallichii Atp Synthase Subunit C, Chloroplastic(Atph) Protein, His-Tagged | +Inquiry |
TMEM215-1614H | Recombinant Human TMEM215 | +Inquiry |
FGFR2-6871C | Recombinant Chicken FGFR2 | +Inquiry |
HNRNPUL2-7771M | Recombinant Mouse HNRNPUL2 Protein | +Inquiry |
ERP44-11137Z | Recombinant Zebrafish ERP44 | +Inquiry |
◆ Native Proteins | ||
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
K1-002CCL | Chinese Hamster K1 Whole Cell Lysate | +Inquiry |
Parietal Lobe-375R | Rhesus monkey Parietal Lobe Lysate | +Inquiry |
SERPINE1-001RCL | Recombinant Rat SERPINE1 cell lysate | +Inquiry |
THAP11-1771HCL | Recombinant Human THAP11 cell lysate | +Inquiry |
NELF-3875HCL | Recombinant Human NELF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nrfB Products
Required fields are marked with *
My Review for All nrfB Products
Required fields are marked with *
0
Inquiry Basket