Recombinant Guinea pig IL23A protein, His&Myc-tagged

• Cat.No.: IL23A-4326G
• Product Overview: Recombinant Guinea pig IL23A protein(Q6LA37)(20-189aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Guinea pig
• Source: E.coli
• Tag: His&Myc
• Protein Length: 20-189aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.2 kDa
• AA Sequence: RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Il23a interleukin 23, alpha subunit p19 [ Cavia porcellus ]
• Official Symbol: IL23A
• Synonyms: IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 p19 subunit; IL-23 subunit alpha; Interleukin-23 p19 subunit; interleukin-23 subunit p19
• Gene ID: 100135557
• mRNA Refseq: NM_001172969
• Protein Refseq: NP_001166440

Q&As

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?

Please inquiry our product manager with specific product.