Recombinant GST protein
Cat.No. : | GST-13 |
Product Overview : | Recombinant GST(1 a.a. - 242 a.a.) was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 1-242 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
AA Sequence : | MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
◆ Cell & Tissue Lysates | ||
CPB-382R | Rabbit anti-GST Polyclonal Antibody | +Inquiry |
GST-573SCL | Recombinant Schistosoma japonicum GST cell lysate | +Inquiry |
CPB-278R | Rabbit Anti-GST Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GST Products
Required fields are marked with *
My Review for All GST Products
Required fields are marked with *
0
Inquiry Basket