Recombinant Golden hamster Ace2 protein, His&Strep II-tagged
Cat.No. : | Ace2-6325G |
Product Overview : | Recombinant Golden hamster Ace2 protein(A0A1U7QTA1)(20-604aa), fused with N-terminal His tag and C-terminal Strep II tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Golden hamster |
Source : | E.coli |
Tag : | His&Strep II |
Protein Length : | 20-604a.a. |
Tag : | His&Strep II |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | IIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWSAFYEEQSKLAKNYSLQEVQNLTIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDDIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYNYNGNQLIEDVERTFKEIKPLYEQLHAYVRTKLMNTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDAMVNQGWNAERIFKEAEKFFVSVGLPYMTQGFWENSMLTDPGDDRKVVCHPTAWDLGKGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAATPEHLKSIGLLPSDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGDIPKEQWMEKWWEMKREIVGVVEPLPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLHKCDISNSTEAGQKLLNMLRLGKSEPWTLALENVVGARNMDVRPLLNYFEPLSVWLKEQNKNSFV |
◆ Recombinant Proteins | ||
ACE2-604H | Active Recombinant Human ACE2 Protein, Fc-tagged | +Inquiry |
ACE2-019P | Active Recombinant Paguma larvata ACE2 protein, hFc-tagged | +Inquiry |
ACE2-231H | Recombinant Human ACE2 protein, hFc-Avi-tagged, Biotinylated | +Inquiry |
ACE2-68H | Active Recombinant Human ACE2, Fc-tagged | +Inquiry |
ACE2-32H | Recombinant Human ACE2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACE2-3100HCL | Recombinant Human ACE2 cell lysate | +Inquiry |
ACE2-1851RCL | Recombinant Rat ACE2 cell lysate | +Inquiry |
ACE2-2085MCL | Recombinant Mouse ACE2 cell lysate | +Inquiry |
ACE2-887CCL | Recombinant Cynomolgus ACE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ace2 Products
Required fields are marked with *
My Review for All Ace2 Products
Required fields are marked with *
0
Inquiry Basket