Recombinant Gadus callarias Allergen M protein, His-tagged
Cat.No. : | Allergen M-4253G |
Product Overview : | Recombinant Gadus callarias Allergen M protein(P02622)(1-113aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gadus callarias |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-113aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.1 kDa |
AA Sequence : | AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Native Proteins | ||
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
PLG-54H | Native Human glu-Plasminogen | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-297H | Human Liver Membrane Lysate | +Inquiry |
CRNN-405HCL | Recombinant Human CRNN cell lysate | +Inquiry |
PSTK-514HCL | Recombinant Human PSTK lysate | +Inquiry |
RGS13-2384HCL | Recombinant Human RGS13 293 Cell Lysate | +Inquiry |
MECR-4394HCL | Recombinant Human MECR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Allergen M Products
Required fields are marked with *
My Review for All Allergen M Products
Required fields are marked with *
0
Inquiry Basket