Recombinant Full Length Zygnema Circumcarinatum Nad(P)H-Quinone Oxidoreductase Subunit 6, Chloroplastic(Ndhg) Protein, His-Tagged
Cat.No. : | RFL32337ZF |
Product Overview : | Recombinant Full Length Zygnema circumcarinatum NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic(ndhG) Protein (Q32RK0) (1-181aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zygnema circumcarinatum (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-181) |
Form : | Lyophilized powder |
AA Sequence : | MIPISESTNTLLFVVLEFAILVGALGVVLLSRVIYSALLLGFVFICVALLYLLLNADFLA AAQVLIYVGAVNVLIVFAIMLVSTPDDVKNKPKTTGEIISAFTFIALFVLLTIMIFTTSW DTHHNLATQDEVLLQPLMSNVQTIGFHLLTDLLFPFELLSLLLLVALVGAITIASKNKIT E |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhG |
Synonyms | ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6 |
UniProt ID | Q32RK0 |
◆ Recombinant Proteins | ||
N6AMT1-3028H | Recombinant Human N6AMT1 protein, GST-tagged | +Inquiry |
RPRD1B-7766M | Recombinant Mouse RPRD1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL31819RF | Recombinant Full Length Rat E3 Ubiquitin-Protein Ligase Rnf167(Rnf167) Protein, His-Tagged | +Inquiry |
Nceh1-4307M | Recombinant Mouse Nceh1 Protein, Myc/DDK-tagged | +Inquiry |
DAZAP1-2357H | Recombinant Human DAZAP1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
IgM-210R | Native Rabbit IgM | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR4-2693MCL | Recombinant Mouse FCGR4 Overexpression Lysate(Met 1-Gln 203), His&Avi-tagged | +Inquiry |
SOCS3-1580HCL | Recombinant Human SOCS3 293 Cell Lysate | +Inquiry |
Liver-302H | Human Liver Right Lobe Lupus Lysate | +Inquiry |
SS18-1468HCL | Recombinant Human SS18 293 Cell Lysate | +Inquiry |
MCPH1-4412HCL | Recombinant Human MCPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhG Products
Required fields are marked with *
My Review for All ndhG Products
Required fields are marked with *
0
Inquiry Basket