Recombinant Full Length Zinc Transporter Zitb(Zitb) Protein, His-Tagged
Cat.No. : | RFL33273SF |
Product Overview : | Recombinant Full Length Zinc transporter zitB(zitB) Protein (Q8Z8B6) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MAHSHSHADSHLPKDNNARRLLFAFIVTAGFMLLEVVGGILSGSLALLADAGHMLTDAAA LLFALLVVQFSRRPPTVRHTFGWLRLTTLAAFVNAIALVVITLLIVWEAIERFYTPRPVA GNLMMVIAVAGLLANLFAFWILHRGSDEKNLNVRAAALHVMGDLLGSVGAIVAALIIIWT GWTPADPILSILVSVLVLRSAWRLLKDSVNELLEGAPVSLDINALQRHLSREIPEVRNVH HVHVWMVGEKPVMTLHAQVIPPHDHDALLERIQDFLMHEYHIAHATIQMEYQMCHGPDCH LNQTPSGHVHHH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zitB |
Synonyms | zitB; STY0799; t2120; Zinc transporter ZitB |
UniProt ID | Q8Z8B6 |
◆ Recombinant Proteins | ||
SIPA1L1-4022R | Recombinant Rhesus Macaque SIPA1L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
lipB-1245B | Recombinant Burkholderia cepacia (Pseudomonas cepacia) lipB Protein (Gly35-Arg403), N-Strep tagged | +Inquiry |
CTSE-1664R | Recombinant Rat CTSE Protein | +Inquiry |
IL36A-2578H | Recombinant Human IL36A protein, His-tagged | +Inquiry |
YLBB-3905B | Recombinant Bacillus subtilis YLBB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8356H | Native Human CGA | +Inquiry |
ppk-8320P | Native Propionibacterium shermanii ppk | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAR1A-2065HCL | Recombinant Human SAR1A 293 Cell Lysate | +Inquiry |
DR1-6820HCL | Recombinant Human DR1 293 Cell Lysate | +Inquiry |
NLGN4Y-3807HCL | Recombinant Human NLGN4Y 293 Cell Lysate | +Inquiry |
NICN1-3830HCL | Recombinant Human NICN1 293 Cell Lysate | +Inquiry |
CD200R1-2226MCL | Recombinant Mouse CD200R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zitB Products
Required fields are marked with *
My Review for All zitB Products
Required fields are marked with *
0
Inquiry Basket