Recombinant Full Length Zinc Transporter Zitb(Zitb) Protein, His-Tagged
Cat.No. : | RFL16272SF |
Product Overview : | Recombinant Full Length Zinc transporter zitB(zitB) Protein (Q83SA2) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDTAA LLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVE GGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWT GWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVH HVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHTTIQMEYQPCHRPDCH LNEGVSGHSHHHH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zitB |
Synonyms | zitB; SF0552; S0560; Zinc transporter ZitB |
UniProt ID | Q83SA2 |
◆ Native Proteins | ||
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP4M1-88HCL | Recombinant Human AP4M1 cell lysate | +Inquiry |
TNFRSF21-2977HCL | Recombinant Human TNFRSF21 cell lysate | +Inquiry |
NMNAT2-001HCL | Recombinant Human NMNAT2 cell lysate | +Inquiry |
CSTF3-7222HCL | Recombinant Human CSTF3 293 Cell Lysate | +Inquiry |
PDYN-3316HCL | Recombinant Human PDYN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zitB Products
Required fields are marked with *
My Review for All zitB Products
Required fields are marked with *
0
Inquiry Basket