Recombinant Full Length Zinc Transporter Zitb(Zitb) Protein, His-Tagged
Cat.No. : | RFL24282YF |
Product Overview : | Recombinant Full Length Zinc transporter zitB(zitB) Protein (Q66D85) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pseudotuberculosis Serotype I |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MAVSAIFSQDSNSKRLLIAFAITTLFMVTEAIGGWLSGSLALLADTGHMLTDSAALFIAL MAVHFSQRKPDPRHTFGYLRLTTLAAFVNAAALLLIVILIVWEAVHRFFSPHEVMGTPML IIAIAGLLANIFCFWILHKGEEEKNINVRAAALHVLSDLLGSVGAMIAAIVILTTGWTPI DPILSVLVSVLILRNAWRLLKESFHELLEGAPQEIDINKLRKDLCTNIYEVRNIHHVHLW QVGEQRLMTLHAQVIPPLDHDALLQRIQDYLLHHYRISHATVQMEYQHCGTPDCGINQAA PADGHHRHHHHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zitB |
Synonyms | zitB; YPTB1164; Zinc transporter ZitB |
UniProt ID | Q66D85 |
◆ Recombinant Proteins | ||
BECN1-445H | Recombinant Human BECN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRD1-9303M | Recombinant Mouse LRRD1 Protein | +Inquiry |
CD27-887H | Recombinant Human CD27 Protein, DDK/His-tagged | +Inquiry |
ADIRF-5670C | Recombinant Chicken ADIRF | +Inquiry |
RFL13357MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 85(Gpr85) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CRP-8374H | Native Human CRP | +Inquiry |
Immunoglobulin G2-82H | Native Human Immunoglobulin G2 | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
MYS-01R | Active Native Rabbit Heavy Meromyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ovary-357H | Human Ovary Membrane Tumor Lysate | +Inquiry |
UBE2L6-568HCL | Recombinant Human UBE2L6 293 Cell Lysate | +Inquiry |
RXFP3-1553HCL | Recombinant Human RXFP3 cell lysate | +Inquiry |
MORN5-4248HCL | Recombinant Human MORN5 293 Cell Lysate | +Inquiry |
CTBP1-7215HCL | Recombinant Human CTBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zitB Products
Required fields are marked with *
My Review for All zitB Products
Required fields are marked with *
0
Inquiry Basket