Recombinant Full Length Zinc Finger Protein-Like 1 Homolog (Cbg06644) Protein, His-Tagged
Cat.No. : | RFL28045CF |
Product Overview : | Recombinant Full Length Zinc finger protein-like 1 homolog (CBG06644) Protein (A8X2R2) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MGLCKCPKRKVTNLFCYEHRVNVCEFCLVDNHPNCVVQSYLNWLTDQDYDPNCSLCHTTL TQGETIRLNCLHLLHWRCFDDWAASFPPTTAPAGYRCPCCSQEVFPPINEVSPLIEKLRE QLKQSNWARNALGLPVLPELNRPVKNIAPIPPPPPPQVKHVSYDDSPAQKEIPIHHNRSE TPATHLEMEDTASYSVSNSDVTFARKKNFASESSSDTRPLLRQDRDADNEENKYKRRPTI DWMRGLWRAKHGTGVPEDRTSGRKMAIFVMFLALLALITIITVLKRAGYNGEHSSDPMFD PMANPNIRVAVDDSRLPHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBG06644 |
Synonyms | CBG06644; Zinc finger protein-like 1 homolog |
UniProt ID | A8X2R2 |
◆ Recombinant Proteins | ||
CDK1-957R | Recombinant Rat CDK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ly6g6e-01M | Recombinant Mouse Ly6g6e Protein, N-His-tagged | +Inquiry |
TCN2-5650R | Recombinant Rat TCN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
S-067S | Recombinant SARS-CoV-2 Spike RBD (A522V) Mutant Protein, His-tagged | +Inquiry |
Itm2a-4337M | Recombinant Mouse Itm2a Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KLK4-239R | Native Rat Kallikrein | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
IGHA1-18H | Native Human IgA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KBTBD4-5083HCL | Recombinant Human KBTBD4 293 Cell Lysate | +Inquiry |
TFRC-950CCL | Recombinant Cynomolgus TFRC cell lysate | +Inquiry |
RNF126-2302HCL | Recombinant Human RNF126 293 Cell Lysate | +Inquiry |
CHTOP-8146HCL | Recombinant Human C1orf77 293 Cell Lysate | +Inquiry |
RCL1-534HCL | Recombinant Human RCL1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CBG06644 Products
Required fields are marked with *
My Review for All CBG06644 Products
Required fields are marked with *
0
Inquiry Basket