Recombinant Full Length Zea Mays Cytochrome C Oxidase Subunit 2(Cox2) Protein, His-Tagged
Cat.No. : | RFL26235ZF |
Product Overview : | Recombinant Full Length Zea mays Cytochrome c oxidase subunit 2(COX2) Protein (P00412) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-260) |
Form : | Lyophilized powder |
AA Sequence : | MILRLLECRFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWMLV RALWHFNEQTNPIPQRIVHGTTIEIIWTIFPSVILLFIAIPSFALLYSMDGVLVDPAITI KAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPAKTHLRM IVTSADVLHSWAVPSLGVKCDAVPGRLNLTSILVQREGVYYGQCSEICGTNHAFMPIVVE AVTLKDYADWVSNQLILQTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COX2 |
Synonyms | COX2; COXII; MOX1; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | P00412 |
◆ Recombinant Proteins | ||
EFEMP2A-1885Z | Recombinant Zebrafish EFEMP2A | +Inquiry |
Isg15-009M | Recombinant Mouse Isg15 Protein, MYC/DDK-tagged | +Inquiry |
Ctsl-823M | Recombinant Mouse Ctsl Protein, His-tagged | +Inquiry |
Angpt2-5309M | Recombinant Mouse Angpt2 protein, His-tagged | +Inquiry |
TLX2-16833M | Recombinant Mouse TLX2 Protein | +Inquiry |
◆ Native Proteins | ||
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
S100BB-10H | Native Human S100BB | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
INTS12-5188HCL | Recombinant Human INTS12 293 Cell Lysate | +Inquiry |
ELF1-548HCL | Recombinant Human ELF1 cell lysate | +Inquiry |
LYPLAL1-4587HCL | Recombinant Human LYPLAL1 293 Cell Lysate | +Inquiry |
PANK1-1278HCL | Recombinant Human PANK1 cell lysate | +Inquiry |
ZDHHC7-192HCL | Recombinant Human ZDHHC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX2 Products
Required fields are marked with *
My Review for All COX2 Products
Required fields are marked with *
0
Inquiry Basket