Recombinant Full Length Yersinia Pestis Bv. Antiqua Undecaprenyl-Phosphate 4-Deoxy-4-Formamido-L-Arabinose Transferase(Arnc) Protein, His-Tagged
Cat.No. : | RFL13557YF |
Product Overview : | Recombinant Full Length Yersinia pestis bv. Antiqua Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase(arnC) Protein (A9R094) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis bv. Antiqua |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MSLNEPIKKVSIVIPVYNEQESLPALIDRTTAACKLLTQAYEIILVDDGSSDNSTELLTA AANDPDSHIIAILLNRNYGQHSAIMAGFNQVSGDLIITLDADLQNPPEETPRLVHVAEEG YDVVGTVRANRQDSLFRKTASRMINMMIQRATGKSMGDYGCMLRAYRRHIVEAMLHCHER STFIPILANTFARRTTEITVHHAEREFGNSKYSLMRLINLMYDLITCLTTTPLRLLSLVG SAIALLGFTFSVLLVALRLIFGPEWAGGGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYN DVRARPRYFVQKVVGAEQTENNQDVEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arnC |
Synonyms | arnC; YpAngola_A2611; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase |
UniProt ID | A9R094 |
◆ Recombinant Proteins | ||
SCO1989-1282S | Recombinant Streptomyces coelicolor A3(2) SCO1989 protein, His-tagged | +Inquiry |
Ins2-3551M | Recombinant Mouse Ins2 Protein, Myc/DDK-tagged | +Inquiry |
INPP5B-27623TH | Recombinant Human INPP5B | +Inquiry |
ARL15-228R | Recombinant Rhesus Macaque ARL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
OPRM1-3170R | Recombinant Rhesus monkey OPRM1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
PJA2-3159HCL | Recombinant Human PJA2 293 Cell Lysate | +Inquiry |
C7orf59-7960HCL | Recombinant Human C7orf59 293 Cell Lysate | +Inquiry |
PDGFRL-3334HCL | Recombinant Human PDGFRL 293 Cell Lysate | +Inquiry |
SOAT2-1583HCL | Recombinant Human SOAT2 293 Cell Lysate | +Inquiry |
PLG-3109HCL | Recombinant Human PLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arnC Products
Required fields are marked with *
My Review for All arnC Products
Required fields are marked with *
0
Inquiry Basket