Recombinant Full Length Yersinia Pestis Bv. Antiqua Cation-Efflux Pump Fief(Fief) Protein, His-Tagged
Cat.No. : | RFL10736YF |
Product Overview : | Recombinant Full Length Yersinia pestis bv. Antiqua Cation-efflux pump FieF(fieF) Protein (Q1C296) (1-300aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis bv. Antiqua |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-300) |
Form : | Lyophilized powder |
AA Sequence : | MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVDSLVDLAASLTNLFVV RYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRHLASPEPLQDPSIGIGV TLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLMNGAILIALALSWYGFRRADA LFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIVTSWPGVIGAHDLRTRRSG QTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVLIHQDPCSVVPKERHAHWEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fieF |
Synonyms | fieF; YPA_3464; Cation-efflux pump FieF |
UniProt ID | Q1C296 |
◆ Native Proteins | ||
C3b-03M | Native Monkey C3b Protein | +Inquiry |
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
FGG -36D | Native Canine Fibrinogen | +Inquiry |
Fxa-281B | Active Native Bovine Factor Xa | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF12-8734HCL | Recombinant Human ARHGEF12 293 Cell Lysate | +Inquiry |
PDE4B-621HCL | Recombinant Human PDE4B cell lysate | +Inquiry |
NECAB3-3888HCL | Recombinant Human NECAB3 293 Cell Lysate | +Inquiry |
C11orf67-8339HCL | Recombinant Human C11orf67 293 Cell Lysate | +Inquiry |
IER2-5298HCL | Recombinant Human IER2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fieF Products
Required fields are marked with *
My Review for All fieF Products
Required fields are marked with *
0
Inquiry Basket