Recombinant Full Length Yersinia Enterocolitica Serotype O:8 / Biotype 1B Low Calcium Response Locus Protein D(Lcrd) Protein, His-Tagged
Cat.No. : | RFL6510YF |
Product Overview : | Recombinant Full Length Yersinia enterocolitica serotype O:8 / biotype 1B Low calcium response locus protein D(lcrD) Protein (A1JU76) (1-704aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia enterocolitica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-704) |
Form : | Lyophilized powder |
AA Sequence : | MNPYDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIAVNMTISVVLLMIAIY INSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYTFGNFVVGGNLIVGIVI FLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMRAGVIDVNEARERRATIE KESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQKGLAAAEALQLYSILTVGD GMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQPKAMLIGGVLLLLFGLIPG FPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSLLTSGSGAPAARTKAKTSGANKGR LGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRRALYLDLGVPFPGIHLRFNEGM GEGEYLISLQEVPVARGELKAGYLLVRESVSQLELLGIPYEKGEHLLPDQETFWVSVEYE ERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQETRYLLEQMEGGYGELIKEVQRIV PLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKEKDVVQLTEYIRSSLKRYICYKYAN GNNILPAYLFDQEVEEKIRSAVRQTSAGSYLALDPAVTESLLEQVRKTIGDLSQIQSKPV LIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQINIQPLGRVCL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lcrD |
Synonyms | lcrD; YEP0018; Low calcium response locus protein D |
UniProt ID | A1JU76 |
◆ Recombinant Proteins | ||
CLCA3P-726HF | Recombinant Full Length Human CLCA3P Protein, GST-tagged | +Inquiry |
MKL1B-7945Z | Recombinant Zebrafish MKL1B | +Inquiry |
CXCR4-4110M | Recombinant Mouse CXCR4 Protein | +Inquiry |
MYL5-3622H | Recombinant Human MYL5, His-tagged | +Inquiry |
PES1-4379R | Recombinant Rat PES1 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
IgA-243C | Native Cat Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIP10-1838HCL | Recombinant Human TRIP10 cell lysate | +Inquiry |
CLCF1-001HCL | Recombinant Human CLCF1 cell lysate | +Inquiry |
HCRTR1-5609HCL | Recombinant Human HCRTR1 293 Cell Lysate | +Inquiry |
VASH1-428HCL | Recombinant Human VASH1 293 Cell Lysate | +Inquiry |
TH-527HCL | Recombinant Human TH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lcrD Products
Required fields are marked with *
My Review for All lcrD Products
Required fields are marked with *
0
Inquiry Basket