Recombinant Full Length Yarrowia Lipolytica Squalene Synthase(Sqs1) Protein, His-Tagged
Cat.No. : | RFL27930YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Squalene synthase(SQS1) Protein (Q9Y753) (1-445aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-445) |
Form : | Lyophilized powder |
AA Sequence : | MGKLIELLLHPSELSAAIHYKLWRQPLHPRDLSKESTELRRCYELLDVCSRSFAAVIREL HPEVRDAVMLFYLILRALDTIEDDMTLSRDIKIPILRDFTKCMKTPGWKFTDSDPNERDR VVLQEFPVVMTEFNKLKPKYQEVIYDITDRMGNGMADYVIDDDFNNNGVDTIAAYDLYCH HVAGIVGEGLTRITILAGFGTDVLHENPRLQESMGLFLQKVNIIRDYREDIDVNRAFWPR EIWHKYAEEMRDFKDPKYSKKALHCTSDLVANALGHATDCLDYLDNVTDPSTFTFCAIPQ VMAIATLDLVYRNPDVFQKNVKLRKGTTVSLILEASNVSGVCDIFTRYARKVYKKSDPND PNYFRVSVLCGKIEQHAALIKRQRGPPAKTIAQLEGERKEMALSLIVCLAVIFSMSGLMA YIAYVSGFRWSPREIFDSKMFPLRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SQS1 |
Synonyms | SQS1; YALI0A10076g; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | Q9Y753 |
◆ Recombinant Proteins | ||
PCED1A-3804H | Recombinant Human PCED1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ABO-426R | Recombinant Rat ABO Protein | +Inquiry |
EIF3M-1692H | Recombinant Human EIF3M Protein (Met1-Ser251), N-His tagged | +Inquiry |
HA-1539I | Active Recombinant Influenza A [A/Guinea fowl/Hong Kong/WF10/99(H9N2)] HA protein, His-tagged | +Inquiry |
L3MBTL3-3508H | Recombinant Human L3MBTL3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
FN1-28900TH | Native Human FN1 | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAC1-3138HCL | Recombinant Human PLAC1 293 Cell Lysate | +Inquiry |
PFTK1-1337HCL | Recombinant Human PFTK1 cell lysate | +Inquiry |
KBTBD4-5083HCL | Recombinant Human KBTBD4 293 Cell Lysate | +Inquiry |
MRPS18C-4147HCL | Recombinant Human MRPS18C 293 Cell Lysate | +Inquiry |
FXYD1-6105HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SQS1 Products
Required fields are marked with *
My Review for All SQS1 Products
Required fields are marked with *
0
Inquiry Basket