Recombinant Full Length Yarrowia Lipolytica Sensitive To High Expression Protein 9 Homolog, Mitochondrial(She9) Protein, His-Tagged
Cat.No. : | RFL1168YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Sensitive to high expression protein 9 homolog, mitochondrial(SHE9) Protein (Q6C7F7) (21-580aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-580) |
Form : | Lyophilized powder |
AA Sequence : | LPLLAQRPNFYRPLTCSALRRNNDHSYRHESRKDKEMQDLKESRKMREQEALDDAAFRNT FEFAVEKTRDSDGKSPEPEVEIDVDREAQTPWDPVGSQSRHETRQEHRERFDDIKKTLPS SVHESQPQMYKWFGEKMDQIQAGALTAGQTLNEVTGYKAIEKLKLSIEKLEDEVLEARAE VREAKRMYSDAISERSNSQREVNELLQRKHNWTPADLERFTELYRNDHANEHSVNDAKKR LGECEHHVEDLTLQLSKQILTRYHEEQIWSDKIRRASTWGTWILMGFNVVLFIVVQLGLE PWKRRRLVGSFEDKVKESLQEWEARNEARRLEEATMAATATQAITELQRRIESPHVSKAD VVEAEAEINSIKTNLATWFKEREEEEKEEIAKEAHELAVIAEDPDMTDVHHKPHPPQPVD TERVVRPHLVENFEHHVADPVHHPTLPITSTPVLEEDAPPPRIHPLVQMSPDSPDDGTKT FTATRDGYDVHPLVVRPTTPPHFMLQVWGAAKLSVESATNKTVAVVRSTFQTAEQRPFES TIVASLGGLCGGLVTFLYLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHE9 |
Synonyms | SHE9; YALI0E01188g; Sensitive to high expression protein 9 homolog, mitochondrial |
UniProt ID | Q6C7F7 |
◆ Recombinant Proteins | ||
CHRNG-3210C | Recombinant Chicken CHRNG | +Inquiry |
NR1H4-117H | Recombinant Human NR1H4, GST-tagged | +Inquiry |
MIAA-3762S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 MIAA protein, His-tagged | +Inquiry |
VAMP8-4958R | Recombinant Rhesus Macaque VAMP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lpp-3814M | Recombinant Mouse Lpp Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
IgA-245R | Native Rat Immunoglobulin A | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry |
PEX5-3285HCL | Recombinant Human PEX5 293 Cell Lysate | +Inquiry |
PSMG3-2734HCL | Recombinant Human PSMG3 293 Cell Lysate | +Inquiry |
LARP6-971HCL | Recombinant Human LARP6 cell lysate | +Inquiry |
OXSR1-707HCL | Recombinant Human OXSR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SHE9 Products
Required fields are marked with *
My Review for All SHE9 Products
Required fields are marked with *
0
Inquiry Basket