Recombinant Full Length Yarrowia Lipolytica Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL36551YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Palmitoyltransferase PFA5(PFA5) Protein (Q6C7D1) (1-334aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-334) |
Form : | Lyophilized powder |
AA Sequence : | MNRAAFRQALRIVFPGVILGLLGYGTYAYCYILCWNLYHHMGYRAGLALLIVYCILKTLV FIYWAAVVIVGPGKVTGVSPLQIFIPGSEVVDEKAQAIVSRQINPKLPDTYICDGWGMPK WCSECQTHKPDRTHHSAIVGHCVPKMDHMCFWVGTVIGQHNYKIFLQYTTLFSTYLIYTL VTTAVFTPRMGQYRRDRGAPDSIPNGNIIALLILTGAWAAFCTSVCLQSFWGVCRNLTAM EGLGRKQGDMVLVNFRYEGKRIIQPLREEDPLPFDQGFAKNWRQVFGTNPLIWFLPFPVV PAAEDYFSNAYGQKFLERIPARWLEGDGREMAAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA5 |
Synonyms | PFA5; YALI0E01804g; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5 |
UniProt ID | Q6C7D1 |
◆ Recombinant Proteins | ||
ADAD1-8426Z | Recombinant Zebrafish ADAD1 | +Inquiry |
GK2-1862R | Recombinant Rhesus monkey GK2 Protein, His-tagged | +Inquiry |
SLC22A7-5120R | Recombinant Rat SLC22A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
P2RY13-12275M | Recombinant Mouse P2RY13 Protein | +Inquiry |
Cd274-359M | Active Recombinant Mouse Cd274 protein, mFc-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1823P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Biotinylated | +Inquiry |
LDL-402H | Native Human Low Density Lipoprotein, High Oxidized, DiI labeled | +Inquiry |
IgG-170G | Native Goat IgG Fc fragment | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
HP-75C | Native Canine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPN-5400HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
Uterus-450S | Sheep Uterus Lysate, Total Protein | +Inquiry |
CRMP1-7273HCL | Recombinant Human CRMP1 293 Cell Lysate | +Inquiry |
RAB33A-2606HCL | Recombinant Human RAB33A 293 Cell Lysate | +Inquiry |
MS4A6A-4122HCL | Recombinant Human MS4A6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PFA5 Products
Required fields are marked with *
My Review for All PFA5 Products
Required fields are marked with *
0
Inquiry Basket