Recombinant Full Length Xenopus Tropicalis Zinc Transporter 6(Slc30A6) Protein, His-Tagged
Cat.No. : | RFL29130XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Zinc transporter 6(slc30a6) Protein (Q5I0B2) (1-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-464) |
Form : | Lyophilized powder |
AA Sequence : | MGTIYLFRKTQRSLLGKLTQEFRLVTADRRSWKILLFGAINVVCTGFLLTWCSSTNSMAL TAYTYLTIFDLFSLITCLISYWVMMKKPSPTYSFGFERFEVLSVFASTVLAQLGALFILK ESAERFVEQPEIHTGRLLVGTFVALCFNLFSMLSIRNKPFAYVSEAASTSWLQEHVADLS RSLCGIIPGLSSIFLPRMNPFVLIDIAGALALCITYMLIEINNYFAVDTASAIAIAVMTF GTMYPMSVYSGKVLLQTTPPHVIGQLDKLLREVSTLDGVLEVRNEHFWTLGFGTMAGSVH VRIRRDANEQMVLAHVTNRLNTLVSSLTVQIFKDEWARPVLASGAMPPNMLNIPDHHVIQ MPSLKSTMDELNPMTSTPSKPSSPPPEFAFNTPGKNMNPVILSNNQTRPSGVGFNYGTTP YTTTFNHGLGVPGIGNTQGLRTGLTNVANRYGTYTPGQFTQFKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc30a6 |
Synonyms | slc30a6; znt6; TEgg064j23.1; TTpA009a14.1; Zinc transporter 6; ZnT-6; Solute carrier family 30 member 6 |
UniProt ID | Q5I0B2 |
◆ Recombinant Proteins | ||
RFL4087GF | Recombinant Full Length Chicken Zinc Transporter 6(Slc30A6) Protein, His-Tagged | +Inquiry |
Slc30a6-527M | Recombinant Mouse Slc30a6 Protein, His-tagged | +Inquiry |
SLC30A6-11679Z | Recombinant Zebrafish SLC30A6 | +Inquiry |
RFL29559DF | Recombinant Full Length Danio Rerio Zinc Transporter 6(Slc30A6) Protein, His-Tagged | +Inquiry |
RFL35738BF | Recombinant Full Length Bovine Zinc Transporter 6(Slc30A6) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC30A6-605HCL | Recombinant Human SLC30A6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc30a6 Products
Required fields are marked with *
My Review for All slc30a6 Products
Required fields are marked with *
0
Inquiry Basket