Recombinant Full Length Xenopus Tropicalis Protein Fam134C(Fam134C) Protein, His-Tagged
Cat.No. : | RFL26011XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Protein FAM134C(fam134c) Protein (Q0P4Z1) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MAQRVGEEEQGASGLRRRRSGARCVEARERDEQVREVQEMLQRGLSSYEPVLSYVQAVLV WERPRHSALLHLALNAAFWFFALTSLRIIFLVAFGLMIIICADQWKNKLWPELGAARASE LENESWGYVHPRLLSVPELCYHAADTWVSVYNFLRNLLLFKTENPGKFCLLACSFLTFLA VLGGYIPGVVLSYLLLLFLLLWPLAIYHQLGRRIYQKLEPALQRLDFSVRGYMMSKYKER QKHNRALPPTDASDSEEELAAFCPSLDDSAVAKELTISDSEHSDAEVSFTENGTFNLSRG QTPLTEGSEDLDRHSDPEESFARDLPDFPSINPDATGIEDDDETSIGIPSTALHPQFSSR QLYEEQESLDAELSLGGFPSTQNITENIAGFVTRGMIQLALAGASQQTHAYAESPRAKQY QRNSSSELDTDAEADDFELLDQSELSQMDPSSSHSHQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | retreg3 |
Synonyms | retreg3; fam134c; TNeu105l15.1; Reticulophagy regulator 3 |
UniProt ID | Q0P4Z1 |
◆ Native Proteins | ||
C1q-04M | Native Mouse C1q Protein | +Inquiry |
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
LEP-27641TH | Native Human LEP | +Inquiry |
ALB-115C | Native Chicken Serum Albumin | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB2-2008RCL | Recombinant Rhesus ERBB2 cell lysate | +Inquiry |
NPAS1-3746HCL | Recombinant Human NPAS1 293 Cell Lysate | +Inquiry |
HIST1H4I-5521HCL | Recombinant Human HIST1H4I 293 Cell Lysate | +Inquiry |
CD3D & CD3E-944HCL | Recombinant Human CD3D & CD3E cell lysate | +Inquiry |
FANCD2-270HCL | Recombinant Human FANCD2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All retreg3 Products
Required fields are marked with *
My Review for All retreg3 Products
Required fields are marked with *
0
Inquiry Basket