Recombinant Full Length Xenopus Laevis Vacuole Membrane Protein 1(Vmp1) Protein, His-Tagged
Cat.No. : | RFL23937XF |
Product Overview : | Recombinant Full Length Xenopus laevis Vacuole membrane protein 1(vmp1) Protein (Q6INE8) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MAENGTDCEQRRVGMPKEQNNGSFQDPSFMCNRKRRDREERQSIVLWRKPLITLQYFILE VLINLKEWSVRLWHRRMMVVSVLLLLAVLSVAYYIEGEHQQCVQYIEKKCLWCAYWVGLG ILSSVGLGTGLHTFLLYLGPHIASVTIAAYECNSVNFPEPPYPDEIICPDEEGTEGAISL WTIISKVRLEACMWGAGTAIGELPPYFMARAARLSGVETDDEEYAEFEEMLEHAQTAQDF ATRAKLTVQNLVQKVGFLGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKLFVIITFSKHIVEQMVSLIGVIPSIGPSLQKPFQEYLEAQRKKLHHKGDSGTPQS ENWLSWAFEKLVIIMVFYFILSIINSMAQSYAKRVQQKKLSVEKTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | vmp1 |
Synonyms | vmp1; Vacuole membrane protein 1 |
UniProt ID | Q6INE8 |
◆ Recombinant Proteins | ||
Prnp-191H | Recombinant Hamster Prnp Protein | +Inquiry |
PCDH8-3711C | Recombinant Chicken PCDH8 | +Inquiry |
MAGI3-3199R | Recombinant Rat MAGI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSNK1D-197H | Recombinant Human CSNK1D, His-tagged | +Inquiry |
C3-3052H | Recombinant Human C3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Blood-011H | Human Blood Lysate, Total Protein | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
Cpn-33 | Native Premium Chlamydia pneumoniae Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
AFTPH-8985HCL | Recombinant Human AFTPH 293 Cell Lysate | +Inquiry |
SPRY1-1491HCL | Recombinant Human SPRY1 293 Cell Lysate | +Inquiry |
GET4-5956HCL | Recombinant Human GET4 293 Cell Lysate | +Inquiry |
PIK3R5-3182HCL | Recombinant Human PIK3R5 293 Cell Lysate | +Inquiry |
CYBRD1-7137HCL | Recombinant Human CYBRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All vmp1 Products
Required fields are marked with *
My Review for All vmp1 Products
Required fields are marked with *
0
Inquiry Basket