Recombinant Full Length Xenopus Laevis Transmembrane Protein 184C(Tmem184C) Protein, His-Tagged
Cat.No. : | RFL36190XF |
Product Overview : | Recombinant Full Length Xenopus laevis Transmembrane protein 184C(tmem184c) Protein (Q6GQE1) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MPCTCGNWRKWIRPLVVLLYILGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPI SLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWIALKYPDIAIYVDTCRECYEAYVI YNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVV RPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPI QPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWKRVQDVATGLQDFIICVEMFLA AVAHHYSFTYKPYVQEAEEGSCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFN DDPEQNEHTSLLSSSTQDPISAASSIPPSPSGHYQGFGQTITPQTTPTAATIPEELYSAD SPEADLQVADHSKVSDDSCNHLDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem184c |
Synonyms | tmem184c; tmem34; Transmembrane protein 184C; Transmembrane protein 34 |
UniProt ID | Q6GQE1 |
◆ Recombinant Proteins | ||
RFL22405RF | Recombinant Full Length Rat Transmembrane Protein 184C(Tmem184C) Protein, His-Tagged | +Inquiry |
TMEM184C-288H | Recombinant Human TMEM184C Protein, MYC/DDK-tagged | +Inquiry |
TMEM184C-9336M | Recombinant Mouse TMEM184C Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32852HF | Recombinant Full Length Human Transmembrane Protein 184C(Tmem184C) Protein, His-Tagged | +Inquiry |
Tmem184c-6485M | Recombinant Mouse Tmem184c Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem184c Products
Required fields are marked with *
My Review for All tmem184c Products
Required fields are marked with *
0
Inquiry Basket