Recombinant Full Length Xenopus Laevis Transmembrane Protein 177(Tmem177) Protein, His-Tagged
Cat.No. : | RFL4602XF |
Product Overview : | Recombinant Full Length Xenopus laevis Transmembrane protein 177(tmem177) Protein (Q66IS8) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MSSPFLWRFLSFTQKYRGTLLAVSSVGLFAANISYHVAPEQTFRKLYQGWSKGEPVQLTA KLQGLFQEVLEETHMGVTSSYVPFSAFGFHPVSAGIPWLPSGCLIGIPFNYNDTEQDGVG IADRVLLINGKEVDWSSDAGTHLRQALNLSLDAQKFSLAREVFYAQGNSPIIQASAAPVC LSGICLSSVAIKQLLGLYSGPILLRGVYNMAVVVLGFAGYFLCSDAVSQWLDYQSDRKVA AVSKSYATGGIEFYEKILAQNRILRTLMGKQGETMYSPSGNLFPNDYLRLKNAPYTSRRD RIKNALLQME |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem177 |
Synonyms | tmem177; Transmembrane protein 177 |
UniProt ID | Q66IS8 |
◆ Recombinant Proteins | ||
IL25-165H | Recombinant Human IL25 Protein | +Inquiry |
GLUD1-2234R | Recombinant Rat GLUD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EVI2B-5357M | Recombinant Mouse EVI2B Protein | +Inquiry |
ITGA4-4998H | Recombinant Human ITGA4 Protein | +Inquiry |
RFL34300SF | Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ylr302C (Ylr302C) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
DES-167C | Native chicken DES | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
Small Intestine-014H | Human Small Intestine Lysate, Total Protein | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRAMD4-5759HCL | Recombinant Human GRAMD4 293 Cell Lysate | +Inquiry |
KLRB1F-1757MCL | Recombinant Mouse KLRB1F cell lysate | +Inquiry |
AKAP14-8940HCL | Recombinant Human AKAP14 293 Cell Lysate | +Inquiry |
RAPGEF4-2520HCL | Recombinant Human RAPGEF4 293 Cell Lysate | +Inquiry |
CPB-054RH | Rabbit Anti-Human IgG Fc Secondary Polyclonal Antibody, HRP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tmem177 Products
Required fields are marked with *
My Review for All tmem177 Products
Required fields are marked with *
0
Inquiry Basket