Recombinant Full Length Xenopus Laevis Sulfhydryl Oxidase 2(Qsox2) Protein, His-Tagged
Cat.No. : | RFL9038XF |
Product Overview : | Recombinant Full Length Xenopus laevis Sulfhydryl oxidase 2(qsox2) Protein (Q6AX23) (30-661aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (30-661) |
Form : | Lyophilized powder |
AA Sequence : | ETLYGPEDSVTILNKESVARAVFNSSSAWLLEFYSSWCGHCINYAPTWKALARDVRDWEP AIKIGVLDCAEEDNYGACKDFGVTLYPTFRFFKAFTKEFTQGENYKAVGDREIQTVRQVI IDFLQTSPAESKPQAWPSLEPISSSEISSLLTPKQSHYTAIIFESEESYEGREVILDLIQ YSNIVVRRALPSDKPILEKLGIGSVPSCYLIQPNGLHGLINDVKSIRSQLSLHLKALSNV RKLLPSETAHSGLSKGVQQEDTTMNQFDRSKLYMTDLESGLHYILRAELANHHTLEGEKL KTFKDFVTILYKLFPGRPHVMKLLETLQEWLVSMPLDTIPYDAILDLVNNKMRISGIFLT NHTQWVGCRGSKSNLRGYPCSLWKLFHSLTVQAAVKPDALANTAFEAEPRAVLQTMRRYI REFFGCRECAKHFEAMAKETVDSVKTPDQAILWLWRKHNVVNNRLSGAPSEDPKFPKVQW PTSDLCSACHSQTGGVHSWNEDEVLAFLKRYYGNQEISLEFADPRKDLSEAATDNGNKEP HFTKKPQERDYVKKQNPQFLDKLVQKKPEKSLDSEAAESSQSVSFLGIGFSNIDMSLCVI LYVTSSLFLMIMFFFFRFRSKRWKVRYNRPFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qsox2 |
Synonyms | qsox2; qscn6l1; Sulfhydryl oxidase 2; Quiescin Q6-like protein 1 |
UniProt ID | Q6AX23 |
◆ Recombinant Proteins | ||
ERBB2-40H | Recombinant Human ERBB2 protein, Fc-tagged | +Inquiry |
RIC3-3709R | Recombinant Rhesus Macaque RIC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hpse-706M | Recombinant Mouse Hpse protein, His-tagged | +Inquiry |
ENO1P1-3312H | Recombinant Human ENO1P1 Protein, GST-tagged | +Inquiry |
HHEX-8575Z | Recombinant Zebrafish HHEX | +Inquiry |
◆ Native Proteins | ||
a-Actinin-20C | Native Chicken a-Actinin Protein | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNPEPL1-2260HCL | Recombinant Human RNPEPL1 293 Cell Lysate | +Inquiry |
FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
KIR2DL1-1701HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
CORO2A-7342HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
KCNIP3-5053HCL | Recombinant Human KCNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All qsox2 Products
Required fields are marked with *
My Review for All qsox2 Products
Required fields are marked with *
0
Inquiry Basket