Recombinant Full Length Xenopus Laevis Solute Carrier Family 25 Member 46-A(Slc25A46-A) Protein, His-Tagged
Cat.No. : | RFL31414XF |
Product Overview : | Recombinant Full Length Xenopus laevis Solute carrier family 25 member 46-A(slc25a46-a) Protein (Q6INQ6) (1-417aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-417) |
Form : | Lyophilized powder |
AA Sequence : | MQPRRPDRFDGLEYRGTSWGRGEGDPPPYQSSFPARSFSSSGDLSQHWVTTPPDIPGSRN LHWGDKSPQYGGADSNAGPPAFGEENSNSANSGEQLNRFAGFGIGLASLFTENVLAHPCI VLRRQCQVNYHARNYQLSPFNIVNIMYNFTKTQGLRALWKGMGSTFIVQGISLGAEGILS EFTHLPRELNHKWNPKQIGGHLLLKGLVYVIVTPFYSASLIETVQSEIIHDNPGILDCLK EGMGRVLNLGVPYSKRLLPLLVLTFPTVLHGILHYIVSSTVQKCVLFFIKKKSPPRLPAD GSNTVQNKLEDYFPELIANFAASLCADVLLYPLETVLHRLHIQGTRTIIDNTDLGHEVVP INTQYEGLKDCINTIKREEGGLGFYKGFGAVVVQYTLHAIVLQITKIIYSSVVQTSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc25a46-a |
Synonyms | slc25a46-a; Solute carrier family 25 member 46-A |
UniProt ID | Q6INQ6 |
◆ Recombinant Proteins | ||
NinI-1369E | Recombinant Escherichia phage lambda NinI Protein (R2-A221), His/Flag-tagged | +Inquiry |
SUD-0022P2-2506S | Recombinant Staphylococcus aureus (strain: 18807) SUD_0022P2 protein, His-tagged | +Inquiry |
SAOUHSC-01263-0044S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01263 protein, His-tagged | +Inquiry |
WDR19-18456M | Recombinant Mouse WDR19 Protein | +Inquiry |
WDR55-1818H | Recombinant Human WDR55 | +Inquiry |
◆ Native Proteins | ||
URG-94H | Active Native Human Urokinase | +Inquiry |
MFGE8-8518B | Native Bovine MFGE8, Fluoresence-labeled | +Inquiry |
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
JKAMP-5103HCL | Recombinant Human JKAMP 293 Cell Lysate | +Inquiry |
CYorf15B-7132HCL | Recombinant Human CYorf15B 293 Cell Lysate | +Inquiry |
Ureter-545C | Cynomolgus monkey Ureter Lysate | +Inquiry |
PILRA-002HCL | Recombinant Human PILRA cell lysate | +Inquiry |
UTP23-446HCL | Recombinant Human UTP23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc25a46-a Products
Required fields are marked with *
My Review for All slc25a46-a Products
Required fields are marked with *
0
Inquiry Basket