Recombinant Full Length Xenopus Laevis Rhodopsin(Rho) Protein, His-Tagged
Cat.No. : | RFL21003XF |
Product Overview : | Recombinant Full Length Xenopus laevis Rhodopsin(rho) Protein (P29403) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MNGTEGPNFYVPMSNKTGVVRSPFDYPQYYLAEPWQYSALAAYMFLLILLGLPINFMTLF VTIQHKKLRTPLNYILLNLVFANHFMVLCGFTVTMYTSMHGYFIFGPTGCYIEGFFATLG GEVALWSLVVLAVERYIVVCKPMANFRFGENHAIMGVAFTWIMALSCAAPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFIVHFTIPLIVIFFCYGRLLCTVKEAAAQQQES LTTQKAEKEVTRMVVIMVVFFLICWVPYAYVAFYIFTHQGSNFGPVFMTVPAFFAKSSAI YNPVIYIVLNKQFRNCLITTLCCGKNPFGDEDGSSAATSKTEASSVSSSQVSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rho |
Synonyms | rho; Rhodopsin |
UniProt ID | P29403 |
◆ Recombinant Proteins | ||
TGFBI-553H | Recombinant Human TGFBI protein, His-tagged | +Inquiry |
SNRPB-1325HFL | Recombinant Full Length Human SNRPB Protein, C-Flag-tagged | +Inquiry |
SPON2A-8638Z | Recombinant Zebrafish SPON2A | +Inquiry |
SAC3D1-7880M | Recombinant Mouse SAC3D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCDH1-5889H | Recombinant Human PCDH1 Protein (Thr58-Asn852), C-His tagged | +Inquiry |
◆ Native Proteins | ||
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
HBA1-5284H | Native Human Hemoglobin, Alpha 1 | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST11-001HCL | Recombinant Human CHST11 cell lysate | +Inquiry |
CLIC5-7445HCL | Recombinant Human CLIC5 293 Cell Lysate | +Inquiry |
OLFM1-3583HCL | Recombinant Human OLFM1 293 Cell Lysate | +Inquiry |
CNKSR3-001HCL | Recombinant Human CNKSR3 cell lysate | +Inquiry |
Lung-860R | Mini Rabbit Lung Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rho Products
Required fields are marked with *
My Review for All rho Products
Required fields are marked with *
0
Inquiry Basket