Recombinant Full Length Xenopus Laevis Nucleolar Complex Protein 4 Homolog B(Noc4L-B) Protein, His-Tagged
Cat.No. : | RFL35705XF |
Product Overview : | Recombinant Full Length Xenopus laevis Nucleolar complex protein 4 homolog B(noc4l-b) Protein (Q6NU91) (1-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-525) |
Form : | Lyophilized powder |
AA Sequence : | MAARKAKHAFRSQATQSDAERQDLDSKLAAVLESRGNANAVFDILEHLESKKEDVVQAAI RTTSKLFEVLLEKRELYIGDLPAEDDSPPDTCSAEDKYKMWMRNRYNSCVSCLLDLLQYS SFSVQELVLCTLMKFIQLEGKFPLENSEWRDSYRFPRELLKFVVDNLLQEEADCTLLITR FQEYLEYDDVRYYTMTVTTECVSRIQQKNKQVLPPVFQTNVFCLLSSINMPVEESTLGNF LVTKNENHEEWKPSKLKEQKRVFERVWMSFLKHQLSVSLYKKVLLILHESILPHMSKPSL MIDFLTAAYDVGGAISLLALNGLFILIHQHNLEYPDFYKKLYSLLEPSVFHVKYRARFFH LANLFLSSTHLPVYLVAAFAKRLARLALTAPPQVLLMIIPFICNLIRRHPACRVLIHRPS AGDLVTDPYIMEEQDPAKSQALESCLWELEVLQQHYHGDVVRAANVISRALSAQESDVSG LLEMSSCELFDKEMKKKFKSVPLEYEPVRGLLGLKSDITAEHFTF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | noc4l-b |
Synonyms | noc4l-b; Nucleolar complex protein 4 homolog B; NOC4 protein homolog B; NOC4-like protein B; Nucleolar complex-associated protein 4-like protein B |
UniProt ID | Q6NU91 |
◆ Recombinant Proteins | ||
LEFTY1-19R | Recombinant Rat LEFTY1 Protein, His-tagged | +Inquiry |
N-5352N | Recombinant Newcastle disease virus (strain Beaudette C/45) N protein, His&Myc-tagged | +Inquiry |
RFL15400PF | Recombinant Full Length Pseudomonas Fluorescens Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
CYP46A1.2-10762Z | Recombinant Zebrafish CYP46A1.2 | +Inquiry |
Glp1r-03R | Recombinant Rat Glp1r Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23-1893HCL | Recombinant Human IL23 cell lysate | +Inquiry |
Placenta-387H | Human Placenta Membrane Lysate | +Inquiry |
MATK-4450HCL | Recombinant Human MATK 293 Cell Lysate | +Inquiry |
KCTD11-5010HCL | Recombinant Human KCTD11 293 Cell Lysate | +Inquiry |
GATAD1-6008HCL | Recombinant Human GATAD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All noc4l-b Products
Required fields are marked with *
My Review for All noc4l-b Products
Required fields are marked with *
0
Inquiry Basket