Recombinant Full Length Xenopus Laevis High-Affinity Lysophosphatidic Acid Receptor Protein, His-Tagged
Cat.No. : | RFL16394XF |
Product Overview : | Recombinant Full Length Xenopus laevis High-affinity lysophosphatidic acid receptor Protein (P79945) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MGCNNTALDNCMLPNLSIATAPLDLRFAFSTPLRMLLAIIMILMIAIAFLGNAIVCLIVY QKPAMRSAINLLLATLAFSDIMLSLFCMPFTAVTIITGSWLFGTQFCQISAMLYWFFVLE GVAILLIISVDRFLIIVQRQDKLNPHRAKIMIAASWVLSFCISLPSVVGWTLVEVPTRAP QCVLGYTEFSADRVYAVMLIVAVFFIPFSVMLYSYLCILNTVRRNAVRIHTHADSLCLSQ VSKLGLMGLQRPHQMNVDMSFKTRAFTTILILFIGFSLCWLPHSVFSLLSVFSRTFYYSS SFYSISTCTLWLTYLKSVFNPVIYCWRIKKFREACLEFMPKTFKILPNVRGRTRRRIRPS TIYVCGEHQSAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Xenopus laevis High-affinity lysophosphatidic acid receptor |
Synonyms | High-affinity lysophosphatidic acid receptor; PSP24 |
UniProt ID | P79945 |
◆ Recombinant Proteins | ||
CD226-248CAF555 | Active Recombinant Monkey CD226 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
AMPK(A1/B1/G3)-243H | Recombinant Human AMPK (A1/B1/G3), His-tagged, Active | +Inquiry |
LRPAP1-6026HF | Recombinant Full Length Human LRPAP1 Protein, GST-tagged | +Inquiry |
RHO-3356H | Recombinant Human RHO protein, His-tagged | +Inquiry |
SCO4569-1151S | Recombinant Streptomyces coelicolor A3(2) SCO4569 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
LDL-243H | Native Human Lipoproteins, Intermediate Density | +Inquiry |
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGED2-4538HCL | Recombinant Human MAGED2 293 Cell Lysate | +Inquiry |
FAM50A-6371HCL | Recombinant Human FAM50A 293 Cell Lysate | +Inquiry |
GMEB1-5884HCL | Recombinant Human GMEB1 293 Cell Lysate | +Inquiry |
CSNK2A1-634HCL | Recombinant Human CSNK2A1 cell lysate | +Inquiry |
UBE2L6-568HCL | Recombinant Human UBE2L6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Xenopus laevis High-affinity lysophosphatidic acid receptor Products
Required fields are marked with *
My Review for All Xenopus laevis High-affinity lysophosphatidic acid receptor Products
Required fields are marked with *
0
Inquiry Basket