Recombinant Full Length Xenopus Laevis Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged
Cat.No. : | RFL10383XF |
Product Overview : | Recombinant Full Length Xenopus laevis Cannabinoid receptor 1(cnr1) Protein (Q801M1) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MKSILDGLADTTFRTITTDLLYLGPNEVQYDDSKGDISSKLVYFPQKLPLSSLRGDPLHE KMTIIDDPLLSIPLDQINATDFYNKSIIFKDTDDNVQCGKNFMDMECFMILTPSQQLVIA ALSIILGTFTVLENMLVLVVIVQSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVF HRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPMSYKRIVTRTKAVIAFCMM WTIAIVIAVLPLFGWNCIKLRSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWK AHNHAVRMLQRGTQKSIIVHTSEDGKVHITRPDQTRMDIRLAKTLVLILVVLIICWGPLM AIMVYDVFGKINKTIKTVFAFCSVLCLLNSTVNPIIYALRSKDLRNAFCSMFPSCQGTAQ PLDNSMESDCQNRHVNNSNAHRAAESCIKSTVKIAKVTMSVSTDTSAEAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cnr1 |
Synonyms | cnr1; Cannabinoid receptor 1; CB-R; CB1 |
UniProt ID | Q801M1 |
◆ Recombinant Proteins | ||
OSR1-1587Z | Recombinant Zebrafish OSR1 | +Inquiry |
RFL19364EF | Recombinant Full Length Escherichia Coli Spermidine Export Protein Mdtj(Mdtj) Protein, His-Tagged | +Inquiry |
Epha2-914M | Active Recombinant Mouse Epha2 protein(Met1-Asn535), His-tagged | +Inquiry |
SNRNP40-15688M | Recombinant Mouse SNRNP40 Protein | +Inquiry |
IBSP-2710H | Recombinant Human Integrin-binding Sialoprotein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
SERPINA3-27285TH | Native Human SERPINA3 | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
KS-01P | Native Pig protein | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMRTC2-6897HCL | Recombinant Human DMRTC2 293 Cell Lysate | +Inquiry |
CNOT4-7401HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry |
GSTZ1-5707HCL | Recombinant Human GSTZ1 293 Cell Lysate | +Inquiry |
ISG20-5151HCL | Recombinant Human ISG20 293 Cell Lysate | +Inquiry |
RNH1-2266HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cnr1 Products
Required fields are marked with *
My Review for All cnr1 Products
Required fields are marked with *
0
Inquiry Basket