Recombinant Full Length Xenopus Laevis Bladder Cancer-Associated Protein A(Blcap-A) Protein, His-Tagged
Cat.No. : | RFL9761XF |
Product Overview : | Recombinant Full Length Xenopus laevis Bladder cancer-associated protein A(blcap-a) Protein (Q4V7Q2) (1-87aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-87) |
Form : | Lyophilized powder |
AA Sequence : | MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLGALFLICYS CWGNCFLYHCSASELPEAAHDPAVVGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | blcap-a |
Synonyms | blcap-a; Bladder cancer-associated protein A |
UniProt ID | Q4V7Q2 |
◆ Recombinant Proteins | ||
Sdc1-8784RAF647 | Recombinant Rat Sdc1 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
RGS1-3689R | Recombinant Rhesus Macaque RGS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YQXI-2981B | Recombinant Bacillus subtilis YQXI protein, His-tagged | +Inquiry |
KCNJ8-260H | Recombinant Human KCNJ8, GST-tagged | +Inquiry |
CXCL3-1690R | Recombinant Rat CXCL3 Protein | +Inquiry |
◆ Native Proteins | ||
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
F2-5402P | Native Porcine Coagulation Factor II (thrombin) | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO36-605HCL | Recombinant Human FBXO36 cell lysate | +Inquiry |
NUAK1-3665HCL | Recombinant Human NUAK1 293 Cell Lysate | +Inquiry |
Kidney-273R | Rat Kidney Membrane Lysate | +Inquiry |
HPS3-5396HCL | Recombinant Human HPS3 293 Cell Lysate | +Inquiry |
ETF1-6533HCL | Recombinant Human ETF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All blcap-a Products
Required fields are marked with *
My Review for All blcap-a Products
Required fields are marked with *
0
Inquiry Basket