Recombinant Full Length Xanthomonas Phage Philf Attachment Protein G3P(Iii) Protein, His-Tagged
Cat.No. : | RFL17070XF |
Product Overview : | Recombinant Full Length Xanthomonas phage phiLf Attachment protein G3P(III) Protein (Q37972) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas phage phiLf (Bacteriophage phi-Lf) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MSPSLFLGWGDDYFVVLWIHGRAVRLGRRQGVGRVIRVSLAMLILLALTFSPIVHATCVQ TEPSTSANNGSWACSDQGEAFAKASSMGVPADLSVCRMKSIRAVSSGPGVFSQRMTYPGD TCGIGYDLDIGTGNATYPDTATCAKRPSQSGWTNPTAPTPSDVCNDGCYYTYAVDAGGPK GYTYVPSGATCTTDDAAPPIDDGGDGDDDGGGDGGGDGGGDGGGDGGGDGGGDGGGDGGG DGGGDGGGDGDGGGDGDGDGDGDGDGEEGGEGAPMSELYKKSGKTVESVLSKFNTQVRGT PMVAGIGDFMKVPSGGSCPVFSLGASKWWDAMTINFHCGGDFLAFLRAAGWVILAIAAYA AIRIAVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | III |
Synonyms | III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein |
UniProt ID | Q37972 |
◆ Recombinant Proteins | ||
GFAP-1902M | Active Recombinant Mouse GFAP protein, His-tagged | +Inquiry |
CPE-199H | Recombinant Human CPE, His-tagged, C13&N15 Labeled | +Inquiry |
RFL33976SF | Recombinant Full Length Stenotrophomonas Maltophilia Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
FASTKD2-19H | Recombinant Human FASTKD2 Protein, GST-tagged | +Inquiry |
P4hb-7294M | Recombinant Mouse P4hb Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF343-2015HCL | Recombinant Human ZNF343 cell lysate | +Inquiry |
SMARCAL1-1646HCL | Recombinant Human SMARCAL1 cell lysate | +Inquiry |
CSNK1A1-617HCL | Recombinant Human CSNK1A1 cell lysate | +Inquiry |
PGC-1705RCL | Recombinant Rat PGC cell lysate | +Inquiry |
PINK1-3929HCL | Recombinant Human PINK1 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All III Products
Required fields are marked with *
My Review for All III Products
Required fields are marked with *
0
Inquiry Basket