Recombinant Full Length Xanthomonas Campestris Pv. Vesicatoria Phosphoglycerol Transferase I(Opgb) Protein, His-Tagged
Cat.No. : | RFL26824XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. vesicatoria Phosphoglycerol transferase I(opgB) Protein (Q3BYI6) (1-702aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas campestris pv. vesicatoria |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-702) |
Form : | Lyophilized powder |
AA Sequence : | MHWMLLVSLLLLLWLLVASPRLAWLKAGLLSLFLLLLSVWGLVDRLSGDGINAATLYHLR ADMDGAGVSDFSGYIAVFVGMLLLSLSPLLLVRVRRFQRPRGGGAVFAGFVGMLLVGIAA SPLYRDGKRLYYQLRPVDYATVVPEYQVPQQPLHKRKNIVWIYGESLERTYFDEQVFPGL MPNLRALATEAVDVRNLASTEGSGWTIAGMVASMCGVPLTTAPGDENSMDRMGMFLPEAR CLGDYLKDQGYRNHYVGGADASFAGKGRFLSSHGFDVVHDVHHFHDQGVAPKHFSAWGVH DDVLLDDAWDTFQTLSRAGQPFMLTTLTMDTHHPAGHLPLACKGQQYDSALGDIGLLHAI KCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMPNDLSDVLAKQKRENLLLFLGKDIAP QQVLTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLARDAPPSASVAASRDSGKDYPRYLA YARTLWTGRSTRMLRINGNGDVVVGVQQVRPPVLLEYDKDTNLKTVYLENTSRQFDRTHS KGTLAYVDRCTAFEDGSADGHWCALVVDRHQSMKLYRDPDLTRGIAVDAPLEATQQGPRP RVRQPIMLTQAARKTDAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQWVVPDAAGRI RMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVKDIPVADRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opgB |
Synonyms | opgB; XCV0446; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase |
UniProt ID | Q3BYI6 |
◆ Recombinant Proteins | ||
AHSA1-467H | Recombinant Human AHSA1 Protein, GST-tagged | +Inquiry |
NUAK2-27531TH | Recombinant Human NUAK2 | +Inquiry |
BRDT-1912H | Recombinant Human BRDT, His-tagged | +Inquiry |
ITPRIP-4657M | Recombinant Mouse ITPRIP Protein, His (Fc)-Avi-tagged | +Inquiry |
Axl-1820R | Recombinant Rat Axl protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
KLK3-387H | Native Human Prostate Specific Antigen (PSA), Low pI Isoform (IEF) | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2N2-144HCL | Recombinant Human CAMK2N2 lysate | +Inquiry |
Thymus-525M | Mouse Thymus Membrane Lysate | +Inquiry |
Spleen-775C | Chicken Spleen Membrane Lysate, Total Protein | +Inquiry |
NDUFA13-3922HCL | Recombinant Human NDUFA13 293 Cell Lysate | +Inquiry |
MPC1-8404HCL | Recombinant Human BRP44L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All opgB Products
Required fields are marked with *
My Review for All opgB Products
Required fields are marked with *
0
Inquiry Basket