Recombinant Full Length Xanthomonas Campestris Pv. Campestris Upf0761 Membrane Protein Xcc0860(Xcc0860) Protein, His-Tagged
Cat.No. : | RFL3814XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris UPF0761 membrane protein XCC0860(XCC0860) Protein (Q8PC75) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MSRVNTMHQWKERLRDRARTASFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFNNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFVCIVLIYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMSAFRYQPEAMRLPPGFEIYGLL RLLGRFRQARLHGNGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGNWLLARDL DVVPLAELYESCQLRVPVEDRPLPCRDDPYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | XCC0860 |
Synonyms | XCC0860; UPF0761 membrane protein XCC0860 |
UniProt ID | Q8PC75 |
◆ Recombinant Proteins | ||
RFL7540SF | Recombinant Full Length Synechococcus Sp. Cytochrome B6-F Complex Iron-Sulfur Subunit(Petc) Protein, His-Tagged | +Inquiry |
PDCL-3161R | Recombinant Rhesus Macaque PDCL Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM185B-1782H | Recombinant Human TMEM185B | +Inquiry |
D19WSU162E-4265M | Recombinant Mouse D19WSU162E Protein | +Inquiry |
HSD17B2-7877M | Recombinant Mouse HSD17B2 Protein | +Inquiry |
◆ Native Proteins | ||
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
Histone-53C | Native Calf Histone Protein | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF213-120HCL | Recombinant Human ZNF213 293 Cell Lysate | +Inquiry |
FLT3-970MCL | Recombinant Mouse FLT3 cell lysate | +Inquiry |
PPIB-2460HCL | Recombinant Human PPIB cell lysate | +Inquiry |
Uterus-77H | Human Uterus Tumor Tissue Lysate | +Inquiry |
KLF6-4926HCL | Recombinant Human KLF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XCC0860 Products
Required fields are marked with *
My Review for All XCC0860 Products
Required fields are marked with *
0
Inquiry Basket